SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012022232.1.53833 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012022232.1.53833
Domain Number 1 Region: 310-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-28
Family HD domain 0.03
Further Details:      
 
Domain Number 2 Region: 207-294
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000535
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Weak hits

Sequence:  WP_012022232.1.53833
Domain Number - Region: 28-64
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0915
Family F1F0 ATP synthase subunit B, membrane domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012022232.1.53833
Sequence length 519
Comment ribonuclease Y [Flavobacterium johnsoniae]; AA=GCF_002221975.1; RF=na; TAX=376686; STAX=986; NAME=Flavobacterium johnsoniae UW101; strain=ATCC 17061; AL=Scaffold; RT=Major
Sequence
MDIITIIIGIVGIAAGFAIAKIIEKSNISNLIKNAKKEAASILKDANLEAENIKKDKILQ
AKERFIELKSEHEQVILARDKKVAEVEKRVRDKESQVSNELSKAKKVNDEFEAKTAEYNN
KIEVLDKKQAEVDKLHKSQLQQLEVISGLSAEEAKEQLVEGLKAEAKTKAMSHIQETIEE
AKLTAQQEAKKIIINTIQRVGTEEAVENCVSVFNIESDDVKGRIIGREGRNIRALEAATG
VEIIVDDTPEAIILSCFDPVRREIARLSLHKLVTDGRIHPARIEEVVAKTAKQIDDEIIE
VGKRTVIDLGIHGLHPELIKVVGRMKYRSSYGQNLLQHSREVSKLCGIMAAELGLNVKLA
KRAGLLHDIGKVPDTESDLPHALLGMQWAEKYGEKDEVCNAIGAHHDEIEMKSLLSPIVQ
VCDAISGARPGARRQVLDSYIQRLKDLEDVAYGFSGVKNAYAIQAGRELRVIVESEKVSD
DNAANLSFEISQKIQTEMTYPGQVKVTVIRETRAVNIAK
Download sequence
Identical sequences A0A1M7DVD8 A5FNQ7
376686.Fjoh_0122 WP_012022232.1.25392 WP_012022232.1.26696 WP_012022232.1.49882 WP_012022232.1.53833 gi|146297888|ref|YP_001192479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]