SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012037224.1.28485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012037224.1.28485
Domain Number 1 Region: 98-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00045
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012037224.1.28485
Sequence length 181
Comment RNA-processing protein [Methanocella arvoryzae]; AA=GCF_000063445.1; RF=representative genome; TAX=351160; STAX=1175445; NAME=Methanocella arvoryzae MRE50; strain=MRE50; AL=Complete Genome; RT=Major
Sequence
MQEHIKVPQDRIGAIIGVDGKIKELLEKKSGAQISVDSESGTVVIDSKEGDPFKALKASD
AIKAIARGFSPEKALKLLDSEDLILDMMDLSKITDTPSDLTRIKGRIIGRGGKTREIIES
MTGAKISVYGKTISIIGDAEQIMTVRTALDMLIDGAPHGAVYGYLERRRREIKQSQFESI
Q
Download sequence
Identical sequences Q0W8M7 Q5NW02
WP_012037224.1.28485 gi|147921591|ref|YP_684592.1| 351160.LRC289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]