SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012083159.1.54627 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012083159.1.54627
Domain Number 1 Region: 17-363
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.19e-27
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012083159.1.54627
Sequence length 376
Comment nitrite reductase [Nitratiruptor sp. SB155-2]; AA=GCF_000010325.1; RF=na; TAX=387092; STAX=387092; NAME=Nitratiruptor sp. SB155-2; strain=SB155-2; AL=Complete Genome; RT=Major
Sequence
MKIIVAFLCIVLTVFAHEKVFVVERENSALAVIENHKLKNEIKNMHNFNHAVVKFIENDG
YVITRDGYLIKFDPIHEKKIAEVQASKSAIGFTLAKDFIAVANYANKTVEIFDRDLHHLQ
TINTGSRNVGIKTYKDYLVFAAMDSDSIWVMKKVVRTYFDQYGTPRQKLFFQKVKIVQNA
GEVPFDAMINKNLYVVGFFNSPFVGVLNLDTFEYKQVPLKLEKRTMVLKVPHFGFWSIMK
DKFFIPAVGDNKVFVFDKDFHFIKAIEVEGNPVFTSLSPDRRFLAVTFSGKKFPIVQIVD
TTDLQVIKRFDFGGMVLHVRWSKEEPLLYVSNNGLSKVIGMDTKKWKKSFEVAVPKPSGI
FIFDMRQGNRLKEALQ
Download sequence
Identical sequences A6Q5Y7
gi|152991531|ref|YP_001357253.1| WP_012083159.1.54627 387092.NIS_1791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]