SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012083161.1.54627 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012083161.1.54627
Domain Number 1 Region: 128-473
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.14e-63
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00032
Further Details:      
 
Domain Number 2 Region: 7-103
Classification Level Classification E-value
Superfamily Cytochrome c 6.92e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.026
Further Details:      
 
Domain Number 3 Region: 480-557
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000114
Family monodomain cytochrome c 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012083161.1.54627
Sequence length 559
Comment cytochrome c [Nitratiruptor sp. SB155-2]; AA=GCF_000010325.1; RF=na; TAX=387092; STAX=387092; NAME=Nitratiruptor sp. SB155-2; strain=SB155-2; AL=Complete Genome; RT=Major
Sequence
MKQIVLLLFLLTFLPASQLIHELEAKNFQKNGYDSYQKYCAVCHGKNREGVSAPPLLPQF
IKRISDKRLHNIIKNSLPQTLMPKFSFLSNREIEAIIRYLRTPAKNITWSKENIVQSKTV
FSSSKKNLGIKNIENVTLVVERGANRVWVMEDEKVLDKFTFKNVHGGLKYTLDGKNFYVP
TRDGWIGHYSLENGRLEEKIRACVNLRNISLSRDAKYLFATCLLPERVVVFERKDLTPVK
MYDVKGKISALYELYSKDEAIFTLRNSPKLYKVNTKTLQFTSYTLDKPIEDFFIDPFEEY
IIGTTRHGKDLRVYDIHSLKEVFMAHIEGMPHLFSATYWYKDGKFYFATPHLRKPYITIW
QMYEWKLVKKIDVGGDGFFVKTHPQSDYLWVDNGSDQLVLVDKEKYTIKKLVPREGKRYI
HTEFSGDGKYAYLSIYEPDGNLLVWQTDTFKELKDYKANIPVGKYNFINKNRKFYPRLFG
LSIFKEKCWGCHHQTAMAFGPPFAQIAKQRSDEEIMAQITDPANTYKFLGYTRNAMPAFH
LSPKELRCIVDYIKSFKDK
Download sequence
Identical sequences A6Q5Y9
WP_012083161.1.54627 387092.NIS_1793 gi|152991533|ref|YP_001357255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]