SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012085665.1.7041 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012085665.1.7041
Domain Number 1 Region: 81-223
Classification Level Classification E-value
Superfamily Sortase 5.36e-33
Family Sortase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012085665.1.7041
Sequence length 238
Comment class E sortase [Kineococcus radiotolerans]; AA=GCF_000017305.1; RF=representative genome; TAX=266940; STAX=131568; NAME=Kineococcus radiotolerans SRS30216 = ATCC BAA-149; strain=SRS30216; AL=Complete Genome; RT=Major
Sequence
MIRRATSVLGELLVTAGVLTLLFVVWQLHWTDLTSGRAQAATVTSLQQQWDAAPAPTATA
GAAATAAPTAPATARAVDETPPTGDAFAILHVPRFGEDYAVPVVEGTGTEELKEGIGHYA
DAALPGEVGNFAIAGHRVTYGKPFHLIADLQEGDAVVVATATQWFTYRVRSHEVVSPKQV
SVIAPVPGRPGETPTEAWLTMTACHPMHSARQRYVVHAQLESVQDRSAGPPASLTAAG
Download sequence
Identical sequences A6W3Y0
gi|152963999|ref|YP_001359783.1| WP_012085665.1.7041 266940.Krad_0027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]