SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012085840.1.7041 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012085840.1.7041
Domain Number 1 Region: 97-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.62e-27
Family GntR ligand-binding domain-like 0.0085
Further Details:      
 
Domain Number 2 Region: 13-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.82e-20
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012085840.1.7041
Sequence length 250
Comment FadR family transcriptional regulator [Kineococcus radiotolerans]; AA=GCF_000017305.1; RF=representative genome; TAX=266940; STAX=131568; NAME=Kineococcus radiotolerans SRS30216 = ATCC BAA-149; strain=SRS30216; AL=Complete Genome; RT=Major
Sequence
MPPAPVSPHRGLLTERIARELEHEIRTGALAVGDKLPSERELSARFAASRGVVREVLRRL
EAQHLIEVAAGRGSFVSSPGLAESRGFDAVYRASRPTVRQLIRARLPLEVESAGLAAELA
TEEDLATLAAAHRAVLEAPDAVAMARADLGFHEAIAVTSGNPVLRIMLLSIGPMMFEMML
RSNSDPSIAEPGVPHHAEILAAITAHDVELARENMREHLALGLRTYGPDLDEPLEVMANR
HLEHLLQHPF
Download sequence
Identical sequences A6WGB9
gi|152968338|ref|YP_001364122.1| WP_012085840.1.7041 266940.Krad_4399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]