SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012087179.1.7041 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012087179.1.7041
Domain Number 1 Region: 76-225
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000549
Family Sortase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012087179.1.7041
Sequence length 226
Comment sortase [Kineococcus radiotolerans]; AA=GCF_000017305.1; RF=representative genome; TAX=266940; STAX=131568; NAME=Kineococcus radiotolerans SRS30216 = ATCC BAA-149; strain=SRS30216; AL=Complete Genome; RT=Major
Sequence
MRPRAGVRAVLACALALVGVLLIAGWWLARPAAGFGTPLPAPPAAAPAPTAPALAPGPVV
TAAVPAPVGRRDAAPVPAAPEPVPVRLEVPALGVDAPVVPVGVDGAGALAVPDDPRVVGW
YRWGPVPGEAGNAVLAGHVDTRDAGPGALFDLQDVADGMLVRVTSSDGSVSEHAVTARRS
YPKDELPTGELFARQGPPQLVLVTCGGDFDPRTGTYEDNVVVTARA
Download sequence
Identical sequences A6WCN1
gi|152967050|ref|YP_001362834.1| 266940.Krad_3106 WP_012087179.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]