SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012096882.1.20576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012096882.1.20576
Domain Number 1 Region: 46-119
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000209
Family Heme-binding PAS domain 0.042
Further Details:      
 
Weak hits

Sequence:  WP_012096882.1.20576
Domain Number - Region: 234-360
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00292
Family Histidine kinase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012096882.1.20576
Sequence length 367
Comment hypothetical protein [Anaeromyxobacter sp. Fw109-5]; AA=GCF_000017505.1; RF=na; TAX=404589; STAX=404589; NAME=Anaeromyxobacter sp. Fw109-5; strain=Fw109-5; AL=Complete Genome; RT=Major
Sequence
MNTLGGVSPGAHALVLLAGVALGVAAVGAWRLISARRRAGLSAPVERVLAGAFECFGDAV
IVLGRDGRVARANGAALRLAGSDVAPLVGKDVAVISEALAALRQGLARAHATQGTVSLRT
GVRAHAAIVRVTGTPPVEVVVLRAEPPRAAPPPLPARAPSLPEPARLGEVLAGAAASVRG
PVARAATAASYLRLLAPPLPPRAAEQLTLLDEALDEAARRVGELHGAAEKAASAPRAVDL
APLVSDLLAAWSPPAGVRVRSAIEPAVALAEDRPLRAAIREALRAAGAGAGRGAEIAVHV
GRRGASAVVEIAGGAGGDDGDAAAVARALVAPHGGRVEDEAVPGRGRMLRILLPRAAEAA
HPHAPPV
Download sequence
Identical sequences A7HC56
WP_012096882.1.20576 gi|153004961|ref|YP_001379286.1| 404589.Anae109_2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]