SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012098725.1.20576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012098725.1.20576
Domain Number 1 Region: 749-911
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-34
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 233-381
Classification Level Classification E-value
Superfamily GAF domain-like 2.01e-24
Family GAF domain 0.0092
Further Details:      
 
Domain Number 3 Region: 409-561
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-22
Family GAF domain 0.016
Further Details:      
 
Domain Number 4 Region: 562-683
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000174
Family Heme-binding PAS domain 0.066
Further Details:      
 
Domain Number 5 Region: 678-757
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000785
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 
Domain Number 6 Region: 78-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000279
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012098725.1.20576
Sequence length 912
Comment multi-sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]; AA=GCF_000017505.1; RF=na; TAX=404589; STAX=404589; NAME=Anaeromyxobacter sp. Fw109-5; strain=Fw109-5; AL=Complete Genome; RT=Major
Sequence
MRAAAPGAIPRARCRPASRSRGTRGRRADSVGVVASVGAPRRRRARKMKRIVPLAGSPML
AAEPGSLNVRDLKNALVDALWSGPAGIAVFDADLRFVGVNDALAAMNGLPPEAHVGRSLA
EILRLLPDDPRRAAVERSEAIARAVLASGRPRRNVPLEPVPPGDRARGWICSYFPLPDVG
ARGGVCVLITDMSDARDRQEQTERARERAEESARRLKLLQEVTAGLSRADTAEAIAQLVV
DRVRVAAGASAGSLRLLEGDELVLAEESGAHAVRGRFPRISTRDSYPVSEVVRRREPIWL
GNVEEFQRFPAFAETAAQLGVRAGVAMPLVGHGYVLGALSLGFAEPRAFGQDERDFLLAV
AEQCAQALGRAQLLEAERTQRRRALQARDRLARLQAVTAALSRASTSSDVARVLVMQAKE
ALGASSSVAYLLDAAGVRLQFAAAVGGAEAEHGRARLVPLDAPLPGAEAVRRGEPIWVEG
AAQLSAQFPELPRWAPHTARMHALVALPLKVGDRVLGVVNFGFDEPRVFDGEERELILAA
AQQCAQALERARLLDAERQARVGEERARATLDAIFDYAPMGIGLIDRELRFVRVNPSLAE
INGLPAAAHAGRTPRELMPDLPNDEVEAAFREVLSSGQPKLDVELSGETPAAPGRLRHWV
ESWYPVRVEDEIFGLGVLVREITAEREAAEFQRNVLGIVGHDLRNPLSAITTSARLVVRQ
AGDPAAVTRLGERIAGNAERMQRIIAVLVDYARVRAGTGIPLRRQPSDLGALCRSVAEEC
EASHPGRHVRASGAPEVHGEWDPDRLCQIIANLLSNALDYSPLDSTVDVSWRAAGERAIV
QVANDGAPIPPALLPTLFDPFRRGERDRAGGKDGLGLGLFIARAIATAHGGTLEVRSAPG
ERTVFTLTMPLR
Download sequence
Identical sequences A7HH95
404589.Anae109_3912 WP_012098725.1.20576 gi|153006750|ref|YP_001381075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]