SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012099195.1.20576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012099195.1.20576
Domain Number 1 Region: 327-495
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-39
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily CheY-like 2.85e-31
Family CheY-related 0.00053
Further Details:      
 
Domain Number 3 Region: 519-635
Classification Level Classification E-value
Superfamily CheY-like 1.99e-26
Family CheY-related 0.0023
Further Details:      
 
Domain Number 4 Region: 127-246
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.2e-16
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number 5 Region: 259-333
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000163
Family Homodimeric domain of signal transducing histidine kinase 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012099195.1.20576
Sequence length 641
Comment hybrid sensor histidine kinase/response regulator [Anaeromyxobacter sp. Fw109-5]; AA=GCF_000017505.1; RF=na; TAX=404589; STAX=404589; NAME=Anaeromyxobacter sp. Fw109-5; strain=Fw109-5; AL=Complete Genome; RT=Major
Sequence
MATILIVDDEPVILDVFRRFLEGDGRRLLLAGSVREALAIAAEAREIDVAIIDKNLGDGS
GLDVARGLKAVKPDAEVILVTGYASIDSAIAAVQIGAYDYVTKPVSDYDALNLKVQNAID
KGRMRREQRDLVARLMESESLHRGVFETSSDPILLVDVDSGRIGDANPAAERLYGEPRER
LRERCYGELQPPGKDGEVATLPAPGARSLPARHRRPDGSELPVELTAGELRLQDRSLRVL
SIRDVSERERAEEARRALEQNLRQAQKMEAVGRLAGGVAHDFSNVLAVILGYSELLMRDL
PAGDARSRESAEGIVEAAHRAAGVTRQLLTLSRKKLLRPEVLSLNKVVQDLGKLLARAIG
ERIELTTRLQDGLWPVLADADQLAQVLLNLAVNARDAMPDGGPLAIETANVELSEPPRDL
PIPAGRYVSLAVRDGGCGMTEEVRSRIFDPFFTTKETGTGLGLATVYGIVRQAGGAIRVD
SEPGQGATFTAFLPVGAEQGGRAHVPVAAAAPRGLGEVVVLAEDEDALRVLLGRVLAGSG
YEVVAGRNGAEALQAARERGGRVDLLLADLVMPRMTGAELAHALQGEQPAMKVLFMTGHT
EDALVEDRLRDGDVELIQKPFTSEILLGHVRRLLGPAKASA
Download sequence
Identical sequences A7HIK4
WP_012099195.1.20576 404589.Anae109_4372 gi|153007209|ref|YP_001381534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]