SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012100968.1.82254 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012100968.1.82254
Domain Number 1 Region: 339-365,398-667
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 5.89e-63
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000581
Further Details:      
 
Domain Number 2 Region: 80-184
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000000000131
Family Sensory domain of two-component sensor kinase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012100968.1.82254
Sequence length 668
Comment chemotaxis protein [Clostridium botulinum]; AA=GCF_000092345.1; RF=na; TAX=758678; STAX=1491; NAME=Clostridium botulinum F str. 230613; strain=230613; AL=Complete Genome; RT=Major
Sequence
MKSIKSKIVTIIAIVCIVSVALCSSISYYFSYKAIMTESTNKVSMASQKYSEMINGWLLT
KAKLMDSMVVDFQYNNKYDQKNIYSYFQSQLKDNKDVIGMYVGFEDKKFISGNGWIPTKD
YDCRQRDWYKEAVEKNGVIYSAPYIDKKFNSMVITVAKPIKKDGKIIGVVGMDVVVDYLK
TLVQKATPVKNSYGFLLDSNNDFIVHPNKEFQPKDEKMTNVNKIMDGKLKDLAQLDSSNN
KVLKSKDYDNKEKIFTRSKIPSSNWSVGFSVPVEEFKKPLNNIIIGFLSVIAISLAAAVI
FALYAGKKISDPILKITELVNETKDLDLTSRNNYETIALYKDETGIIGRAVIDLREELKN
IVEELKKSSKDVLKYSEIVNGATDETVQSIEAISTTVDELAKGSVDQAKDAQNGSEKLFS
LAEEIKITHNSTNLVKTYSLETKENSGKGILSMEETIDKFKENNRVNKELGKNVEMLSNK
SGSIGEIINSIQSIAEQTNLLALNAAIEAARAGEAGKGFAVVAEEIRKLAEQTSISTKEI
ENIVREIQFEIDNTKNNMDLSEKVVGEVNDAMKISKKSFDIITKSIVDIINQIEILVENV
NKVDSDKEEVLTSIQGISAIAEESAASTEEVSASVEEQTASMESISQTAKDLKEITSTLD
ELVNKFKI
Download sequence
Identical sequences A7GIF3
441772.CLI_3351 gi|384463532|ref|YP_005676127.1| WP_012100968.1.24613 WP_012100968.1.68062 WP_012100968.1.82254 WP_012100968.1.96435 gi|153938254|ref|YP_001392563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]