SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012106122.1.2930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012106122.1.2930
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-123
Family Methyl-coenzyme M reductase gamma chain 0.000000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012106122.1.2930
Sequence length 254
Comment methyl-coenzyme M reductase [Methanoregula boonei]; AA=GCF_000017625.1; RF=representative genome; TAX=456442; STAX=358766; NAME=Methanoregula boonei 6A8; strain=6A8; AL=Complete Genome; RT=Major
Sequence
MAYKPQYCPGQTQVAENRRKQLDPNHKLEKIRDVTDKDLVLIMGHRAPGSAYRAVHPPLS
EQQEPACPIRKIVTPTDGAKAGDRVRYIQFSDSMYNAPCQPYQRSWLESYRYRGIDPGTL
SGRQIIECRERDLEKYAKELVNTELFDPALTGVRGCTVHGHSLRLDENGLMFDMLQRCIL
DKKSGVIKYVKDQVGVPLDSEVKVGKAQDEKWLKSHTTMYHSLVGTGFRDDAEYVEYIQR
IHALRVKYGFMPKE
Download sequence
Identical sequences A7I5U0
gi|154150126|ref|YP_001403744.1| WP_012106122.1.2930 456442.Mboo_0583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]