SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012117732.1.80280 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012117732.1.80280
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-35
Family SMI1/KNR4-like 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012117732.1.80280
Sequence length 154
Comment MULTISPECIES: hypothetical protein [Bacillus amyloliquefaciens group]; AA=GCF_002002555.1; RF=na; TAX=492670; STAX=492670; NAME=Bacillus velezensis; strain=CH13; AL=Contig; RT=Major
Sequence
MDFYLKVKEFIADNAKEKDFTGGIGEDKILKIEQDLQVTLPDSYKWFLRKYGSGGVYGID
LLGYDFGGASVVETTREYHEYRGLPSGLVVIEHVDFFGYCLDTNKINSEGECPVVIWSEF
GGYKELNSAHFIKFFYERLHEMKENWEEDADWDD
Download sequence
Identical sequences A7Z5G8
WP_012117732.1.37657 WP_012117732.1.44318 WP_012117732.1.80280 gi|556557679|ref|YP_008727214.1| 326423.RBAM_018820 gi|154686314|ref|YP_001421475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]