SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012118190.1.44318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012118190.1.44318
Domain Number 1 Region: 35-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.05e-27
Family SMI1/KNR4-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012118190.1.44318
Sequence length 185
Comment MULTISPECIES: hypothetical protein [Bacillus amyloliquefaciens group]; AA=GCF_000494835.1; RF=na; TAX=1412898; STAX=1390; NAME=Bacillus amyloliquefaciens CC178; strain=CC178; AL=Complete Genome; RT=Major
Sequence
MAVFVEKTLQGLKELIDEKGRLKILGNEGALLETECIFFKGATDLEIESFEKKIKVSLPE
DYKTFLKLHNGARIFDLLFYGENVGGGLHILNVEEIEKYMQNGFLKPQFIPVAHLLDGCY
LLIDKTKMSTDPNYLWFRGFVEYEPMQLNFEIFLDRYIMSQGANFWEWNIYTAENYYRTH
QGDED
Download sequence
Identical sequences A7Z7P3
gi|556558510|ref|YP_008728045.1| gi|154687089|ref|YP_001422250.1| WP_012118190.1.37657 WP_012118190.1.44318 WP_012118190.1.80280 326423.RBAM_026610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]