SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012118623.1.80280 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012118623.1.80280
Domain Number - Region: 21-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0129
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012118623.1.80280
Sequence length 180
Comment MULTISPECIES: hypothetical protein [Bacillus amyloliquefaciens group]; AA=GCF_002002555.1; RF=na; TAX=492670; STAX=492670; NAME=Bacillus velezensis; strain=CH13; AL=Contig; RT=Major
Sequence
MDTFENYIKYDTVDERITLRYKDKLPAELIEVWDKYGLGTLLNGFLKVINPDEYLDILER
CYMRYEQAIPIFTTSMGDIIVWEKDKYVNLLNFRKGHVHVVSSGFDFFFDDLKDNDFMND
ELMWEPYPEASRIYGKPDYDECFGYTPLLGLGGSEKVKNLEKVKLREHILIITEFMGPIE
Download sequence
Identical sequences A0A2D1HUF8 A7Z9I8
326423.RBAM_033340 WP_012118623.1.37657 WP_012118623.1.44318 WP_012118623.1.54902 WP_012118623.1.80280 WP_012118623.1.86493 gi|556559209|ref|YP_008728744.1| gi|154687734|ref|YP_001422895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]