SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012120127.1.48654 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012120127.1.48654
Domain Number 1 Region: 285-430,494-525,761-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-20
Family ABC transporter ATPase domain-like 0.033
Further Details:      
 
Domain Number 2 Region: 11-110,142-237
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000000000628
Family PHP domain 0.0074
Further Details:      
 
Weak hits

Sequence:  WP_012120127.1.48654
Domain Number - Region: 498-662
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family BAR domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012120127.1.48654
Sequence length 909
Comment chromosome segregation protein SMC [Roseiflexus castenholzii]; AA=GCF_000017805.1; RF=representative genome; TAX=383372; STAX=120962; NAME=Roseiflexus castenholzii DSM 13941; strain=DSM 13941; AL=Complete Genome; RT=Major
Sequence
MTEKSLYHGARWIRCDLHLHSPGAHGFTFPPGLSAAQRDEVVAQYVQQLQAQGIAIAAIT
DYQQIRTKWFIPIQQEAKKAGIYVYPGVELSFGGSVAGKYGLHVLAIFPYDSDLQEINRR
IDKLLDGDVQEELVRENGSHRDLKPRENLADCLIRLRRETGCLLVFAHPNDENGLWKTYQ
PGEAADLLVRVEPDAIEQFEERDRQRLQDTGKVHPTLLGRIACVRSSDNHSIAEIGTKTL
SEGAPRATYVKLSVLDDLRAIRLALHDHALLVRVGEPPKAEYTHFVHLEIEGNGFLGGLS
LDFSPEMNVLIGGRGVGKSALLEVIRYALDLPAYAPTAYREGLVKHALGSGGKVVLAFYQ
VVRPGIERHYRIERVWDEQPRVFEGERSVSLSPLEVLGEREAPLFFGQREIYEVTQSARL
RRRLLDEIIGRTAEMQLGQVKRITEELQRNARTILEHQERLAQRKDLEKRLQEIEHQIAL
YQQYGITQKLQQATALARDEERLKRAHEQLSQAQADWQEVQQRLAEHWTNALAGLKQADS
VQAALLQQAAEVLRGLQDAFDGYLQQGEASFQQARAEFDRLLARWEQERRPLDEEIQRLK
RELGTQSLDPDVLIRLTQEQEALRPQWETLRKIETTTANLQEERREKLADLREQRRQVFQ
LRQQQAQVISQALKDRVSVVVEYRGQRQEFAERLSAFFSGSGLDKESLRRLAEKGTDGIA
LAEWVRQGEKALCQNADLTSARAQQMLRFLEQNPQRIYELEVLAPEDEVEVQLKVNDLWL
PLEKLSAGQRATAMLLILLTQHDRLLLIDQPEDDLDNRFIFDDVVPLLREQKGKRQIIAA
THNPNIPVLGHAELVVALEAQEEHAAVAIQGAIDRKTVQDVVRRVMEGGEEAFRRRAEKY
GLNIQGGSG
Download sequence
Identical sequences A7NJM9
383372.Rcas_1607 WP_012120127.1.48654 gi|156741588|ref|YP_001431717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]