SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012123296.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012123296.1.33635
Domain Number 1 Region: 3-138,173-383
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.23e-95
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000543
Further Details:      
 
Domain Number 2 Region: 384-536
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.97e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00027
Further Details:      
 
Domain Number 3 Region: 140-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000445
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012123296.1.33635
Sequence length 561
Comment methionine--tRNA ligase [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MAKWIVGSAWPYVNTVPHLGNLIGSVLSADVFARFLRLMGEDVVFVSGSDEHGTPIEVEA
RKRGVEPKELTDKVHEYVKKLFEKYLISFDNYTRTHNPVHMEFVRETFMKIYENGYIFTQ
EMVMPYCPKDKMFLPDRFTVGTCPYCGAPDARGDQCERCGKLLDPPDLVNPRCAFCGSRP
VWRKTLHWFFDLPKAAEGLVEWLERSELPNNVKKFTLNWVKEGLTPRSVTRDNKWGIPAP
FPGAEGKTIYVWFEAVLGYLSAVKELDVKNGTNLFEEFWKDINSRPVYFIGKDNIPFHSI
ILPALLKATGEEYPLPYNISATEYLMYEGQKFSKRRRVGVWIDEALEVVPNPDYWRFALI
RMRPEERDTNFTWREFYRIVNSELNDDIGNFAHRVLTFVERRFGGSVRGRVDEEVKKSIA
ELHEKYVKAMYKVKLKEASGLVLEMARLGNKYLNEKEPWRLLKEGKEEEARDVMYTCLFI
LREVALHLAPFAPSAAEELWKMIGEPGSVHERGKLLTSGSEPAGEVKEPKPLFQKLPKDF
LERVDELLEEARRKVEKLRPI
Download sequence
Identical sequences A8ABN0
gi|156937943|ref|YP_001435739.1| 453591.Igni_1155 WP_012123296.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]