SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012123350.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012123350.1.33635
Domain Number - Region: 154-237
Classification Level Classification E-value
Superfamily Prefoldin 0.000314
Family Prefoldin 0.017
Further Details:      
 
Domain Number - Region: 105-174
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0209
Family Occludin/ELL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012123350.1.33635
Sequence length 294
Comment hypothetical protein [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MRSNALEVKLDEINAEIEELRKERAELITKIKELRAQRKALIEKKRAEVERLRELRAERA
KLVEELRQLKESRREAKQKLNQVLEELKKLKSIVEQGKRGPSPNSLRRRIQQLEWRLQTN
VLTREEEEEIVREIARLEEALERLTKVEEAKKKLIELRAELARLRLLIKSYNENINEISN
KISEVDGRISNVREEVDRLNGKIDELKAKIDEYSKKVEEIDLKLSQLREEKRKLVEEIKK
GEAMAAKNKGEALLSELAKRAKEKMERGEPLTFEELQALMMVEGDGQENIGSNG
Download sequence
Identical sequences A8ABT4
gi|156937997|ref|YP_001435793.1| WP_012123350.1.33635 453591.Igni_1210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]