SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012123400.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012123400.1.33635
Domain Number 1 Region: 11-174,234-339
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.45e-35
Family tRNA pseudouridine synthase TruD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012123400.1.33635
Sequence length 345
Comment tRNA pseudouridine(13) synthase TruD [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MRRPHPIDYYVGMTKYFLNLEACEGRVLRPKGFRVIELSEPSPGPSYVYLLLKEGIDTIH
ALREIRRRLGGKWYHLGLKDANGVTLQLLSSDVVSEGLQLRLRKGCLVLTPLGRGSINKA
RMWGNAFVIDLQCSKPHSLEGKVKVPGYFSYQRFGTARPVSHVVGKMILLERWEEAVEAL
LGEPTPWESEAARRVRLEYYSEGPRAYLRAPKFMDVERRVAFELLRGSSPKRALKKSGLT
ELFLHAYQSYLYNKRLSEFDDPCEGPEALPGPGAEGYEELLEEEGVTLELFKKFGLRAAP
RRPCYETYVKSFARGDGRVTLIFKLPRGYYATSLLREIVRDPFAV
Download sequence
Identical sequences A8ABY4
453591.Igni_1260 WP_012123400.1.33635 gi|156938047|ref|YP_001435843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]