SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012125958.1.98221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012125958.1.98221
Domain Number 1 Region: 283-474
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-46
Family Ribonuclease PH domain 1-like 0.0000193
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-45
Family Ribonuclease PH domain 1-like 0.0000238
Further Details:      
 
Domain Number 3 Region: 124-214
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.35e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 432-529
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.32e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 205-307
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.28e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0017
Further Details:      
 
Domain Number 6 Region: 590-674
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.49e-22
Family Cold shock DNA-binding domain-like 0.0000246
Further Details:      
 
Domain Number 7 Region: 536-604
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.83e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012125958.1.98221
Sequence length 690
Comment polyribonucleotide nucleotidyltransferase [Cronobacter sakazakii]; AA=GCF_002094595.1; RF=na; TAX=28141; STAX=28141; NAME=Cronobacter sakazakii; strain=cro909W; AL=Scaffold; RT=Major
Sequence
MMARQATAAVMVSMDDTAVFVTVVGAKKAKPGQDFFPLTINYQERTYAAGRIPGGFFRRE
GRPSEGETLIARLIDRPLRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLS
GIPFNGPIGAARVGYINDQYVLNPTQDELKSSKLDLVVAGTESAVLMVESEAELLSEDQM
LGAVVFGHEQQQVVIQNINDLVKEAGKPRWDWQPEAANEALNARVKALAESRLSDAYRIT
DKQERYSQIDAIKADVIAALQAEQAEGDALDENELGDILHAIEKNVVRSRVLAGEPRIDG
REKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTERDAQNIDELMGERTDRFLF
HYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPAADRFPYTVRVVSEITESNGSS
SMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGENFVVLSDILGDEDHLGDMDFKVAGS
REGITALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPRGDISQFAPRIHTI
KISPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAE
IEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLE
VDRQGRVRLSIKEATEQTQEAAAPAAPEAE
Download sequence
Identical sequences A0A0F6VQC8 V5U4P9
gi|156935691|ref|YP_001439607.1| gi|389842510|ref|YP_006344594.1| WP_012125958.1.98221 gi|565647196|ref|YP_008898492.1| 290339.ESA_03557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]