SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012143845.1.70442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012143845.1.70442
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-43
Family SMI1/KNR4-like 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012143845.1.70442
Sequence length 133
Comment SMI1/KNR4 family protein [Shewanella sediminis]; AA=GCF_000018025.1; RF=representative genome; TAX=425104; STAX=271097; NAME=Shewanella sediminis HAW-EB3; strain=HAW-EB3; AL=Complete Genome; RT=Major
Sequence
MHDIIEQLQELSETVPIPLELPTFEQIVVVEEEILMPLPSELKEYLLYASDVIYGTIEPV
TASDPYSHTYLSEVTAYAWSIGMSREYVAICQQGNSFYCIDQEGQVMLWSEDGLESETWE
SFWQWAEEVWMQS
Download sequence
Identical sequences A8FZ42
WP_012143845.1.70442 425104.Ssed_3511 gi|157376643|ref|YP_001475243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]