SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012149561.1.98304 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012149561.1.98304
Domain Number 1 Region: 92-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-30
Family DsbA-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012149561.1.98304
Sequence length 264
Comment thiol:disulfide interchange protein [Rickettsia akari]; AA=GCF_000018205.1; RF=representative genome; TAX=293614; STAX=786; NAME=Rickettsia akari str. Hartford; strain=Hartford; AL=Complete Genome; RT=Major
Sequence
MQNIIGKILVIFVFVIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLL
KTPEIIIESIEGLQKRKVQENETKVNNYLKDHKLGIEDSTSFPIIGNKDGDVVIIAFYDY
NCSYCKKGDIFINELLQNDPKVKVILRPLPILGDASEYLARIVLSVYKVNPSKFKAVHDE
LINIRDVSNESIKELLTENGLNAMEIEEIADSNEIKDFITQNMKIARSLRIQGVPAYIID
SKLIPGLIDFPQLLNIVKEIRDAR
Download sequence
Identical sequences A8GNF3
WP_012149561.1.98304 gi|157825716|ref|YP_001493436.1| 293614.A1C_03210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]