SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012149810.1.98304 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012149810.1.98304
Domain Number 1 Region: 49-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-53
Family Glutathione peroxidase-like 0.0000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012149810.1.98304
Sequence length 205
Comment SCO family protein [Rickettsia akari]; AA=GCF_000018205.1; RF=representative genome; TAX=293614; STAX=786; NAME=Rickettsia akari str. Hartford; strain=Hartford; AL=Complete Genome; RT=Major
Sequence
MKMQSNIIKIIIVISLLIGVGALYLLLSLSTPEKPLAGQVNIYEDNVNIGGDFELIDQNG
EIFNSETLKGNLSLVYFGFTSCPDICPTSLNNMTKIVEILNKHKIDILPIFITIDPKRDT
PEVLKEYLKHFHPKFIGLTGNEQQIKDVADKFKVFYARVNGDDDDPNYMLDHSSFTYLID
ANGKYLKHFYLDSSPKDIMEFLRNE
Download sequence
Identical sequences A8GP55
293614.A1C_04570 WP_012149810.1.98304 gi|157825968|ref|YP_001493688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]