SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012150530.1.76853 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012150530.1.76853
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-46
Family Translational machinery components 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012150530.1.76853
Sequence length 159
Comment 30S ribosomal protein S9 [Rickettsia rickettsii]; AA=GCF_000283935.1; RF=na; TAX=1105101; STAX=783; NAME=Rickettsia rickettsii str. Hlp#2; strain=Hlp#2; AL=Complete Genome; RT=Major
Sequence
MPELKIKTEKVEKQLTKEPLVLKTPKEKIDNLGKFYATGKRKNAIARVWLKVGKGKIVVN
KKTIAQYFPSETYVKTILQPFVLTKTIDQYDIICTVRGGGISGQKGAILHGISKALDKSA
PDFRAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR
Download sequence
Identical sequences A8GRA1 B0BWQ1
gi|378723704|ref|YP_005288588.1| gi|379018820|ref|YP_005295054.1| gi|379017493|ref|YP_005293728.1| gi|378720994|ref|YP_005285881.1| gi|165932894|ref|YP_001649683.1| gi|378722347|ref|YP_005287233.1| WP_012150530.1.17801 WP_012150530.1.31136 WP_012150530.1.3339 WP_012150530.1.38731 WP_012150530.1.4490 WP_012150530.1.74071 WP_012150530.1.76853 WP_012150530.1.77680 WP_012150530.1.78650 WP_012150530.1.81845 WP_012150530.1.83836 WP_012150530.1.89241 gi|379016743|ref|YP_005292978.1| gi|157828192|ref|YP_001494434.1| 392021.A1G_01800 452659.RrIowa_0381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]