SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012150853.1.3339 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012150853.1.3339
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-45
Family Ribonuclease PH domain 1-like 0.0000696
Further Details:      
 
Domain Number 2 Region: 295-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-42
Family Ribonuclease PH domain 1-like 0.0000247
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.67e-28
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 4 Region: 149-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.23e-24
Family Ribonuclease PH domain 2-like 0.0027
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 621-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.56e-18
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000602
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012150853.1.3339
Sequence length 748
Comment polyribonucleotide nucleotidyltransferase [Rickettsia rickettsii]; AA=GCF_000283795.1; RF=na; TAX=1105105; STAX=783; NAME=Rickettsia rickettsii str. Arizona; strain=Arizona; AL=Complete Genome; RT=Major
Sequence
MFNEITKSVTWNGQVLELSTGKIARQADGAVTVKMGNSVLLCTAVVANKAKEGIGFLPLT
INYREMAYAAGKIPGGFFKHEGKPSDREVLVSRLIDRPIRPLFHPAFVNETHVTCSVLSY
DPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLINGEFVLNPTLALLKTSQLDLVVA
GTSDSVMMVESEAHLLSEEQMLEAVKFGFESFQPVIKIIKELAEEAKKPKLEMQALYPAS
LKKEIEKLFVKEIEQAFAMKSKQERSTNLDLITEKVFTHFVSDIENKKYSHYQIESALKA
IESGILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLVKEGKNFAVLS
DILGDEDYFGDMDFKVAGTGEGITALQMDIKISGVDFKIMKVALEQARLGRLHILEQMNK
VISKPNNELSKNAPSTTTIKIDKDKIRDIIGPGGKVIKEICETSGAKIDISDDGTVSVYA
SDRDKLKVALDKIKAIVVEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERI
ETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKFSNNTKPKTSVNNTKDNSEPEQR
HDSSKKRAWNEDNNAEIAEVITERKYFN
Download sequence
Identical sequences A8GS96 B0BXR0
gi|379016389|ref|YP_005292624.1| gi|378721351|ref|YP_005286238.1| gi|165933253|ref|YP_001650042.1| gi|378724055|ref|YP_005288939.1| WP_012150853.1.17801 WP_012150853.1.31136 WP_012150853.1.3339 WP_012150853.1.38731 WP_012150853.1.4490 WP_012150853.1.74071 WP_012150853.1.77680 WP_012150853.1.78650 WP_012150853.1.81845 WP_012150853.1.83836 WP_012150853.1.89241 gi|157828537|ref|YP_001494779.1| 392021.A1G_03770 452659.RrIowa_0793 gi|379017842|ref|YP_005294077.1| gi|378722698|ref|YP_005287584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]