SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012151092.1.78650 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012151092.1.78650
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-17
Family RNase P protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012151092.1.78650
Sequence length 118
Comment ribonuclease P protein component [Rickettsia rickettsii]; AA=GCF_000831525.1; RF=na; TAX=1338411; STAX=783; NAME=Rickettsia rickettsii str. R; strain=R; AL=Complete Genome; RT=Major
Sequence
MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKA
VVRNKIKRRIRHLIRIIVSDSSFKDIKFAMIIIPRKGFEEINFSHLNYELSKLILRNI
Download sequence
Identical sequences A8GT00 B0BUJ2
gi|379019409|ref|YP_005295643.1| gi|379018100|ref|YP_005294335.1| 392021.A1G_05160 452659.RrIowa_1112 gi|378721613|ref|YP_005286500.1| WP_012151092.1.17801 WP_012151092.1.31136 WP_012151092.1.3339 WP_012151092.1.38731 WP_012151092.1.4490 WP_012151092.1.74071 WP_012151092.1.76853 WP_012151092.1.77680 WP_012151092.1.78650 WP_012151092.1.81845 WP_012151092.1.83836 WP_012151092.1.89241 gi|157828791|ref|YP_001495033.1| gi|378722960|ref|YP_005287846.1| gi|165933519|ref|YP_001650308.1| gi|379016141|ref|YP_005292376.1| gi|378724314|ref|YP_005289198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]