SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012156655.1.79101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012156655.1.79101
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-16
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012156655.1.79101
Sequence length 130
Comment SMI1/KNR4 family protein [Shewanella pealeana]; AA=GCF_000018285.1; RF=representative genome; TAX=398579; STAX=70864; NAME=Shewanella pealeana ATCC 700345; strain=ATCC 700345; AL=Complete Genome; RT=Major
Sequence
MPFNLSEVQLSNTELELGAKLPHDYREAMKADNGGEASTEEDDWELYPIKDTSDRKRLVR
TCNHIIVETSSCRGFGSFPEGALAIAGNGLGDQMIFLRDNDKFRDIVYLWLHETGEVQEL
ADSFRGIEKL
Download sequence
Identical sequences A8H869
gi|157963257|ref|YP_001503291.1| 398579.Spea_3443 WP_012156655.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]