SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012164151.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012164151.1.67183
Domain Number 1 Region: 43-226
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000741
Family GAF domain 0.011
Further Details:      
 
Domain Number 2 Region: 241-467
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000902
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012164151.1.67183
Sequence length 474
Comment serine phosphatase [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MSRVPLPNQPSQSLDLDYPGVATNVATVTALQELVSHLRREQAKAQDLLSSLSFSLRSFN
NLNQFLALIPLIVSRVTDADAAALILFRPNGQVSLEQLYCHEGQQCRNIRLALENVTRQF
TVNGSPAKQPNLVLEQQLGHLLGTNYQWFSTAILVRNFELHERGRLYLFSSNPDYEWTET
RQKLAQLVADQTAVAIENDTLTTQLRKQERITRELEIGAEIQARLLPNYSPKIEGVALAA
TCQTANQVGGDYYDFIPIYRQLPTSRQYRLNQADRWGLVIGDVMGKGVPAGLIMTMTRGI
LRADALHHHSPAEILKNLNQVMYADLENSNRFVTLFYSEYDPKTRQLSFSNAAHNPPLLW
RARENVIERLDTDGMLIGLDANTEYQEDKVTLSPGDTIIYYTDGFTDAAGPNGDRFDEEN
LIAVFQEACHTCHGPQEILDYLFERLQAFMGERNQSGDDVTLIVMQITPMLMTF
Download sequence
Identical sequences B0C5Q5
gi|158336918|ref|YP_001518093.1| WP_012164151.1.67183 329726.AM1_3789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]