SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012164767.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012164767.1.67183
Domain Number 1 Region: 11-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-112
Family GABA-aminotransferase-like 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012164767.1.67183
Sequence length 391
Comment spore coat protein [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MPRSKDQFLVFGSPAIEEAEMQEVMASMRTGWLGTGPKVMRFEQDFCTYKGSQHAIAVNS
CTAALHLSLLAAGLNPGDEVITTPLTFCATANAIIHAGGVPVLADVDPETMNIDPAQVEA
KITDRTKAIIPVHFAGRPCEMDALCALAEQYSLVLIEDCAHAIETEYQGRKAGTFSNFGC
FSFYVTKNITTGEGGMILTQTQEDTDRIKVLALHGMSQDAWKRFSDDGYNHYQVVEAGFK
YNMMDIQAAIGIHQLQRVTPYWNRRQQIWQQYNQALADLPLTLPTPPAPNTVHGYHLYTL
LIDESQTGISRDQFLVAMHRQHIGTGVHYLSLPEHPYYQHRFGWQPQDYPHATRIGQQTV
SIPLSAKLNDLDVEDVVAAVHQSLDTSAIAA
Download sequence
Identical sequences B0CG05
WP_012164767.1.67183 329726.AM1_4475 gi|158337594|ref|YP_001518769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]