SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012164828.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012164828.1.67183
Domain Number 1 Region: 15-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-55
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 402-513
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.36e-31
Family Pentapeptide repeats 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012164828.1.67183
Sequence length 532
Comment serine/threonine protein kinase [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MSYCLNPACTNPSNAPRQMVCQACGSNLVLRDRYRSTRILGRGGFATTFLAEDEGLPGKP
TCVIKQLRPVVTAPHILEMSRELFQREAETLGKIGNHPQLPRLLDYFELGQEFFLVQEYV
KGATLQQEVRRSGPFDESMVYNVLEEVLPLMEHLHSVEVIHRDLKPANIIRREIDDKLVV
IDFGAVKDQVSQTAIANPDENSTLTSFAVGTPGFAPPEQMAMRPVYASDVYSLGVTCIYL
LTGKSPKDLSYNPVSGELSWREHVRVGPELQEILGKMLEISLRDRYRSAKEVLQALAKNA
SGPSSGISASQPPRRSSSSSRSYSPTRPRSNSPSSRAASGIRRYNSRAQSPLSGALSKVS
GQLSTPRSSYTGLDSSSSLSSRGPKKARLTPNAVQHAYGRGQRDFSGQDLRNLNLRKFQL
PSANFHEGKFQNTDLRDAILINANFGRANFTGANLRNANLMQAYMSHADLANADLRGANL
SDAYLSHANLRGANLCGADLSGAKLSESQLSFAQTNWLTVYPNGKRGKKGRC
Download sequence
Identical sequences B0BZ74
gi|158337660|ref|YP_001518836.1| WP_012164828.1.67183 329726.AM1_4542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]