SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012165409.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012165409.1.67183
Domain Number 1 Region: 4-192,241-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.33e-73
Family TK-like PP module 0.004
Further Details:      
 
Domain Number 2 Region: 315-506
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-61
Family TK-like Pyr module 0.012
Further Details:      
 
Domain Number 3 Region: 492-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.36e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012165409.1.67183
Sequence length 635
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MHLSEIVHPNQLHGLSISELKQIANQIREKHLDTVATSGGHLGPGLGVVELTLALYQTLD
LDQDKVVWDVGHQAYPHKLITGRYERFHTLRQKDGVAGYLNRRESKFDHFGAGHASTSIS
SVLGMALARDAKGENFKTVAVIGDGAMTGGMALEAINHAGHLPHTRMLVILNDNDMSISP
NVGAMSRYLNKMRLSPPIQFLSDNFEEQLKQLPFGEQVAPDLKRLKGGMKRLAVSKVGAV
FEELGFTYIGPVDGHSLEELLATFKEAHLHEGPVLVHVATTKGKGYAIAEQDQVSYHAQS
PFNLETGKAKPSNKPKPPSYSKVFAETLIKMAENDIRVVGITAAMATGTGLDKLQAKLPK
QYIDVGIAEQHAVTLAAGMACEGMRPVVAIYSTFLQRGYDQIIHDVCIQNLPVFFCLDRA
GIVGADGPTHQGMYDIAYLRCLPNMVMMAPKDEAELQQMLVTGINYTDGPIAMRYPRGSG
LGVGLMEEGWEPLPIGKAETLRHGDDVLLLAYGTMVNLASQVADMLTEHGVRATVVNARF
AKPLDTELIIPLAQKIGQVVTLEEGCLPGGFGSAVLEALMDHQVMAPVTRIGVPDQLVEH
ATPDQSKAELGLTPAQVAERVLGLLKQKPAPSYVS
Download sequence
Identical sequences B0C8J3
WP_012165409.1.67183 329726.AM1_5186 gi|158338290|ref|YP_001519467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]