SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012166211.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012166211.1.67183
Domain Number 1 Region: 32-216,340-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-34
Family HI0933 N-terminal domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012166211.1.67183
Sequence length 678
Comment halogenase [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MKPLNASPPISQPINSTTAQKNAGHRLPVGRIDVAIIGSGIAGSTLGAILARQGLKVILF
EAGSHPKFAIGESMILETSEMMRSLSERYDIPELAYFSSENYFERIGTSHGVKRHFSFAH
HSEGQPFDQQRTLQAVIPKQPYGHELHLYRQDTDYFLMTVAIRYGAQVMQNTPVQSVEIN
EVGVALLTQSGEQFEADYIVDAGGFRSLLAEQFDLRHHNLQTHSRAIFTHMVDVPCFHEV
TAPKETYQLPFQLSEGTLHHVFKGGWLWVIPFDNHAKSTNPLCSVGLMLDPRVYPAQPEL
SPEVEFFQFIERFPSIAEQFRQAKAVRNWTRTGRIQYSAKQVVGDRFCLLGQAAGFIDPL
FSKGLYTALACTSALAERLLTAKETGDYSAAYFRSVEALTLAYIQANDQLVTHAYQSFSD
YRLWSPFSVLWLTGAYLELVKLTSSRALAINRQEYDQQLQTLRLAGGGFPEFEQLAQHIY
TLVDRTTLSRDIPKLAQQMTQQLEQASWMPQVFKAVLNGKNHLPSNKLHPRLLRSKKGFM
GTGQYQTHFFGDRTLPFFLSFYLRERIKYSQRLLQFKRDLKLWNRGLLHPVRWSAAVSRV
MPLTLATLVTTYLSIPQSYRFSIENRSDHSLINVLANPTQFQLNCSSFVSDVVDVRMSGD
LPTFAIKTPCNIQSTNNQ
Download sequence
Identical sequences B0C3S8
329726.AM1_6083 gi|158339157|ref|YP_001520334.1| WP_012166211.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]