SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012182279.1.77205 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012182279.1.77205
Domain Number 1 Region: 1-56,89-344
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6.63e-57
Family Gtf glycosyltransferase 0.018
Further Details:      
 
Domain Number 2 Region: 391-465
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000942
Family Gtf glycosyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012182279.1.77205
Sequence length 467
Comment hypothetical protein [Salinispora arenicola]; AA=GCF_000375165.1; RF=na; TAX=1169166; STAX=168697; NAME=Salinispora arenicola CNY256; strain=CNY256; AL=Scaffold; RT=Major
Sequence
MRIVIAVQPSHAHLWPITPVAWALQSAGHEVRVATHARFADSVRAAGLTPVGLGDPAADE
ARTRSDARPPARPEEVLRYADVLGLDEQGREHWIAFYQWLLNPISDYIRADLPYAVDLVD
FARAWRPDLVIWDATMAAASMAARVSGAAHARFTLNLDYPGWCFDRLRERRAELRAAGLS
ENPVADLLQPLADKYGIEVDDEILYGQWTIDPMPTGMSLPTSATVLPVRYVPFTGADLIP
EWLRGAPQRPRVALTLGESTRRFIKGDWGRTPKILEAVADLDIEVVATLNAQQLEGVEQV
PDNVRALEWVSLTQLMPTCSAVIHHGGGGTFAAPVAFNLPQIVCDTDESLMMQPVEVDPR
TMADGTYRVGFEFGVSEEVVQTVTTWQLPGKKLEATPTADYVVRRGAGVRLDHYEKSVEE
VRTMIQDVVREPSYRDGARAIFDTWLAMPSPADIVPLLERLAGEHRR
Download sequence
Identical sequences A8M0G7
gi|159037715|ref|YP_001536968.1| WP_012182279.1.14007 WP_012182279.1.18430 WP_012182279.1.23841 WP_012182279.1.35493 WP_012182279.1.63836 WP_012182279.1.69805 WP_012182279.1.77205 WP_012182279.1.79888 WP_012182279.1.88482 391037.Sare_2112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]