SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012206725.1.33911 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012206725.1.33911
Domain Number 1 Region: 31-216
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.78e-34
Family RNA methyltransferase FtsJ 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012206725.1.33911
Sequence length 217
Comment MULTISPECIES: ribosomal RNA large subunit methyltransferase E [Delftia]; AA=GCF_000741825.1; RF=na; TAX=80866; STAX=80866; NAME=Delftia acidovorans; strain=2167; AL=Scaffold; RT=Major
Sequence
MKVNTKSKKVNKAWLNSHVNDPYVKAAQKDGYRARAAYKLKEIDEQLKLIRPGATVVDLG
STPGAWSQYVRRCLSPEGAAVGALNGRIISLDLLPMEPIEGVQFILGDFREEPVLAQLQE
ALGGGKADVVVSDMAPNLSGNGTTDAARIALLVELAVDFSIHHMKPEGALVVKLFHGGAY
DDLVALFRQTFKVVKPIKPKSSRDKSSETFLVGMGLK
Download sequence
Identical sequences A0A080NQ12 A0A210W595 A0A2G6TSJ4 A0A2G6WF80 A9BML0
398578.Daci_4926 WP_012206725.1.21606 WP_012206725.1.33911 WP_012206725.1.66548 WP_012206725.1.82428 WP_012206725.1.89816 gi|160900358|ref|YP_001565940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]