SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012234140.1.90317 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012234140.1.90317
Domain Number 1 Region: 83-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.59e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 22-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000107
Family Glutathione S-transferase (GST), N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012234140.1.90317
Sequence length 216
Comment glutathione S-transferase family protein [Sorangium cellulosum]; AA=GCF_000067165.1; RF=representative genome; TAX=448385; STAX=56; NAME=Sorangium cellulosum So ce56; strain=So ce 56; AL=Complete Genome; RT=Major
Sequence
MSELIIWTYDWVPEGPRGFVRDLRLRWACEEADLIYVVKTIPFDGRETNHLARQPFGQAP
FLNDGELDIFESGAGLLHLARKSDKLMPPDPAGEAETLQWTIAALNSIEMVTVPWWFLEI
CGDEDNQLAGWMGKRLDQLEKVLSEREWLAAGRFTVADLLMADVLRVPKVRAFGDRPATE
AYVTRVTDRPSFKRAQADQIRLFEAADEKRTEKGAN
Download sequence
Identical sequences A9FCH3
gi|162449776|ref|YP_001612143.1| WP_012234140.1.90317 448385.sce1505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]