SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012235489.1.90317 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012235489.1.90317
Domain Number 1 Region: 45-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-34
Family Glutathione peroxidase-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012235489.1.90317
Sequence length 203
Comment ahpC/TSA family protein [Sorangium cellulosum]; AA=GCF_000067165.1; RF=representative genome; TAX=448385; STAX=56; NAME=Sorangium cellulosum So ce56; strain=So ce 56; AL=Complete Genome; RT=Major
Sequence
MRPSPSPSFARVLAALCASLALSLAGGCGGAAPVAPPAPETGGGLIGSAAPELAAEVVSG
EGPSTLKDARGKVVIVDFWATYCRPCRRSFPKYQELVDRFGGNLAVLAVSLDAPEDVSTE
QIAGFADEAGVRFKILWDKDQRAEKAYRPRRMPTAFVVDRGGVVRHIHAGYEDGEEDKIS
REIEALLGPAAAPPPADGGRRSP
Download sequence
Identical sequences A9GEI6
448385.sce2858 WP_012235489.1.90317 gi|162451130|ref|YP_001613497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]