SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012241490.1.90317 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012241490.1.90317
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000022
Family Glutathione S-transferase (GST), N-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 157-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000375
Family Glutathione S-transferase (GST), C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012241490.1.90317
Sequence length 242
Comment glutathione S-transferase [Sorangium cellulosum]; AA=GCF_000067165.1; RF=representative genome; TAX=448385; STAX=56; NAME=Sorangium cellulosum So ce56; strain=So ce 56; AL=Complete Genome; RT=Major
Sequence
MITLHSFGPMFGLPEASPYVTKTEVQLKLLGLPYTKERARPDQSPKGQLPFIDDGGARIA
DSHFIREHLEKKHGKDLDAGLDARQRAEAWAVERMIEHQLAAASGCARWLIPENFAKGPA
NFVNGAPEEARPKLREELLARVRENFRAMGIGRHSDAEIVELGARSLSALSALLGDEPYL
FGARPAGVDATAFAVLAGLLTPFFDSPLRRRAEGFANLTAYTARLMKEFYPDHPWEAPRP
GA
Download sequence
Identical sequences A9G5M8
448385.sce8879 gi|162457164|ref|YP_001619531.1| WP_012241490.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]