SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012243819.1.55099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012243819.1.55099
Domain Number 1 Region: 175-378
Classification Level Classification E-value
Superfamily Lysozyme-like 2.45e-68
Family Family 19 glycosidase 0.000017
Further Details:      
 
Domain Number 2 Region: 41-163
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.2e-38
Family Ricin B-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012243819.1.55099
Sequence length 378
Comment endochitinase [Renibacterium salmoninarum]; AA=GCF_000018885.1; RF=representative genome; TAX=288705; STAX=1646; NAME=Renibacterium salmoninarum ATCC 33209; strain=ATCC 33209; AL=Complete Genome; RT=Major
Sequence
MFTARKDHPAVKKLLALLTASAAAALLLVAAPGAAQAATTGTITGIGGKCIDAAAGKSDN
GTAVQIYDCNGTNAQQITIGDDQSIRMLGKCLDIVDRSTSNGGKVQLWDCANSANQKWAF
SNASEIVNPAANRCLDAEGQKSDNGTRLMIWDCTGNPNQKWTVHPSGNPPSNSEFPISEA
QFNQLFPNRNSTYSYQGLVSGAKKYPAFATTGDDATKKREVAAFLANVQHETGSLQYLRE
LNTANYPHYCDRSQPYGCPAGGDQYYGRGSLQLSWNYNYKAAGDSLGFDLLNNPDQVATN
PTLAWGTGLWYWNTQSGGASTSSHDSIVQNRGFGETIRSINGGLECNGNGADSRNARINY
YKNIAGVLGVDPGGNLSC
Download sequence
Identical sequences A9WKV3
288705.RSal33209_0356 WP_012243819.1.55099 gi|163839120|ref|YP_001623525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]