SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012258737.1.35445 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012258737.1.35445
Domain Number 1 Region: 170-213,252-449,548-665
Classification Level Classification E-value
Superfamily Subtilisin-like 1.2e-66
Family Subtilases 0.0016
Further Details:      
 
Domain Number 2 Region: 459-529
Classification Level Classification E-value
Superfamily PA domain 0.00000112
Family PA domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012258737.1.35445
Sequence length 1115
Comment MULTISPECIES: peptidase S8 [Chloroflexus]; AA=GCF_000022185.1; RF=na; TAX=480224; STAX=480224; NAME=Chloroflexus sp. Y-400-fl; strain=Y-400-fl; AL=Complete Genome; RT=Major
Sequence
MSRLFSRNYLVALTLLLSLVLAGILPLRPVEAQPRPDRPTPGTPLTIEPLTASSREDVAV
NKNLALSRDGTLASVFLKIDSPSLASFMAQNGITDINAPAAQDYLRQLNAELDALIAQAQ
QRIPGLIVTHRFDLIIGGVSVAAPVSHLDQLRRLPNVVEVINDRIERIETYRTPAFIGAT
TAWNRGGGSAFAGEGVIFGVLDSGVWPEHPSFSDPDPLGKPYAPPPPAPGNPGGLRACNF
GSATPGDAPFTCNNKLIGSYRFMSAYDFFVGTQPYEFRSGRDDDGHGTHTASTAAGNRGV
PASDGSRVFGTISGIAPRAYIVNYKVCGELGCFTTDSAAAVQQAIRDGVHVINFSISGGT
NPYSDIASLAFLDAYNAGILVSASAGNSGPAPDTVNHREPWVATVGASTSDRSYLSTLTV
QGSSGTFTAVGASSGAGISTPAPVVVNTTDPLCLNPAAAGTFTGQIVVCERGIIARVAKS
ANVAAGGAIGMILYNPTPSSLDADFHSIPTVHIQNTDGSALLAFLTANPGATATFTPGAP
GPIQGDVMAGFSSRGGPGQTLGISKPDVTAPGVNILAGYTAIEYGQAVPQFAFLSGTSMS
SPHNAGAAILLKWLNPTWTPGQIKSALMTSAKAAGVYKEDGVTRFTPFDAGSGRIDLRKA
WDPGLTFDETGANYLALQNELWKANYPSLYVPRMPGLITVSRTVREVSGYNSFYKSTISY
QAGQPRDFKVIVPKEFFVPANGTYTFNITVDARDVPLGQVRHAVVIFTERNGCQVRFPVT
IVRGEPDIRMEKQCDPATLALRGTTDCTISITNTTFNDVTVTLNDTMPKQLKLVSGSVTG
GATETSNGLTFSGTLTGASPPNISAGRLTFNGYLSLASLGASPNVSLGDETIANFTLSRP
FVFGGQTYNTIGMVSNGYAVIGGGTAADVQYINRTFPNPARPNNTLGAFWTDLDGSAGGG
YYAYLVGFGPCSNPANACWLILEWENAPNWGDGELNTFQIWIGLNGVEDITYSYGPTLSD
GDSGYVTVGAENAFGNRGANIYSNDGFGPIVGTIPTANSNDVYIATTPGTPGQTITIGFR
AQGVRLGRWTNYAELTSPSFFGTYIDPFSGEVVRP
Download sequence
Identical sequences A9WFA0
324602.Caur_2885 480224.Chy400_3121 gi|222526355|ref|YP_002570826.1| gi|163848429|ref|YP_001636473.1| WP_012258737.1.35445 YP_001636473.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]