SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012261363.1.99908 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012261363.1.99908
Domain Number - Region: 360-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0183
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012261363.1.99908
Sequence length 488
Comment hypothetical protein [Bacillus weihenstephanensis]; AA=GCF_000018825.1; RF=na; TAX=315730; STAX=86662; NAME=Bacillus weihenstephanensis KBAB4; strain=KBAB4; AL=Complete Genome; RT=Major
Sequence
MTNKNETGWNLESSYTVLPKSFFTEIPPTPVHSPELIKLNNSLAISLGFNPEELKKDAEI
AILAGNTIPEGAHPLAQAYAGHQFGHFNVLGDGRALLIGEQITPSGERFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVSTGEPIYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLKALADYTIKRHYPEVESTENPYVALLQEVIKRQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDSYNQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENNWFLGIKKKLGLFSNEEHDQSLIE
KLLKAMEKYKADYTNTFRALTDNILENAPLFKSPEFKEWYELWQSRLERQKESKDDAYKL
MKNNNPVIIPRNHRVEEALEAAVKDGDYSVMEKLLQALANPYEYSQEQADYCTPPVPSNR
PYRTFCGT
Download sequence
Identical sequences A9VNN2
315730.BcerKBAB4_3221 gi|163941141|ref|YP_001646025.1| WP_012261363.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]