SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012264031.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012264031.1.4043
Domain Number 1 Region: 535-643
Classification Level Classification E-value
Superfamily CalX-like 4.84e-24
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 2 Region: 157-284
Classification Level Classification E-value
Superfamily beta-Roll 9.42e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00059
Further Details:      
 
Domain Number 3 Region: 418-531
Classification Level Classification E-value
Superfamily CalX-like 3.4e-21
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 4 Region: 304-399
Classification Level Classification E-value
Superfamily beta-Roll 5.41e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 5 Region: 325-381,647-774
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000183
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012264031.1.4043
Sequence length 836
Comment calcium-binding protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MTSSLLPILPAVDDVLFNFAQSDGFWANLAIAFGASYDVVKATELRQQWKSRNFSQLPPI
EVLSGEVLGTANGAYSSSTNKIYLSASFLNTASSAAIINVILEEIGHYVDAQVNQVDSAG
DEGAIFAELVQGNSLDVATLEALRAENDQTTIIVNGEIIQVEQADFTGTNGNDNITGTSG
DDNIYGLGGNDTLSGLAGNDRLEGGSGNNTLYGGTGNDVFNFAYPLNTNTSDVAMDFVQG
QDKIDVSSLNLSDWATLQLLISNDGKNNALITTFFDGVQSQLKLNGINPTLLQASDFIFN
TINLNQSIDGDDFYTYNDQLFGGLGNDTLRGFKGNDTLFGEQGDDRLDGGSGSDTLYGGL
GDDTAVYTGNRSQYSWTSNQGVFTITDSVANRDGIDTLYGIQKLQFSDQIVTIAPEEDFP
SITLAVSPSSVTEDGTANLVYTFTRSGSTTNPLTVNYSIGGTATNGTDYASIPTGVIFAA
NSATVTVIVDPTADTIVESNETVILTLASGTGYTVGTPNAATGTITDDDTSVTSQLSIND
ITVVEGKDNHAILTVTVDNPNPQPITFNYTTAPINATANVDYTSKTGTITIAANTATATI
SIPILNDNLNEPDEAFTVTLSNPVNATINPEGGIGEVIITDTWQSTLTRTLPNNVENLRL
IGSNNINGTGNAGNNKITGNSGINQINGRAGIDTLTGGLGADTFIFQFGQSTISTRDRIT
DFAINSDKIDLLTQGGTATSAPSNFSRAANSTVTTLQNLINQVFTDANGATTGNQGLGVN
SAALVQVTTGAIAGTYLVINDSAAGFQSSNDLLINITGFTGALPALGNIPVGNFFV
Download sequence
Identical sequences B0JN05
449447.MAE_03470 gi|166363088|ref|YP_001655361.1| WP_012264031.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]