SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012264749.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012264749.1.4043
Domain Number 1 Region: 541-670
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000131
Family Serralysin-like metalloprotease, C-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012264749.1.4043
Sequence length 702
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MTVDQNSIVGLYVIYFNRSPDPQGLTFWQSQDVTIEEMAAQFGASPEAKSLYPFLASPTL
GDPVAFINEIYQNAFGRDADDAGLEYWSGVLEQDSSPEAVAEFVLAVAQGAQGTDRVALQ
NRADIALQFTQEALNAGIPFTASLFATSSQIIDTVTFTDESVADAEDAIEQAIIDIIGGG
TGTTFTLLEQGAVLTAAASTHVSPADKFLSTANDQINGTVFLDGSVIQDPSTSDNDVLTA
TILPDVFDFQTIPFISKIEDIKLTGSPGGVVDIANITDVKTLEFVTGNITVLTSEKHPLN
LAEGYAGTLTVLQTNKNSQTTINLNGTVAGTRIVDGLVDNLIIKDTRFQNNASQINIVVK
ADSVLKASDTTTNPTIRDTQTGENTNFVISGDKNLTIDGAVQMARGNSTAQLDATALTGK
LTLNLANILSTEVDPFSVKQIVGGKSDDSFTLTAITNQLVGVAINGSDGEDTITASLGDE
TSILALNRVTNVETVIVKQTSFVNTVLNPNDSFVASGKSATVDASSFTVSKLTYDGSLET
NGTLNIIGGALKDTLEGGAKNDTLTGGASADTLTGGPGTGNDTFVYKSIADSNFDSTIAF
DTITDFQVAGDVLNLKAVGFTSTQFLGTFEAKQDTLLDAAKAVSFNIGKNALAAFTYTGA
EDLFKDNTFVLGTNNSAIDVVDAGDLFIQLTDDLTLTSVNFA
Download sequence
Identical sequences B0JTV1
449447.MAE_13170 WP_012264749.1.4043 gi|166364058|ref|YP_001656331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]