SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012265390.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012265390.1.4043
Domain Number 1 Region: 89-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000142
Family Galactose-binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012265390.1.4043
Sequence length 242
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MTNNILSRVTVFTTTATLILYCNINPAKATNIQGAISVSTNLGVGSSEFDISNIINKSGL
FIPYTNGQDLNGYLAQNPFHTYVGQNNDWFSGFNAASILPGIVDFNLGSLFSITDFVLWN
GDAAGIQNFDLVVSSVSDFSSFTSVGSFVANFNPNGVSYLPQRFSFSPANAQFVRLKINT
SYPFTNGFISIGESAFGVGTKSIPESSSVLGLLALGTLGVGSLIKSKVMGKKPKNDSQEV
EN
Download sequence
Identical sequences B0JG00
449447.MAE_21830 gi|166364924|ref|YP_001657197.1| WP_012265390.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]