SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012265968.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012265968.1.4043
Domain Number 1 Region: 370-425,509-744,778-807,883-968
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.97e-73
Family Myeloperoxidase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 1081-1250
Classification Level Classification E-value
Superfamily beta-Roll 2.81e-30
Family Serralysin-like metalloprotease, C-terminal domain 0.0004
Further Details:      
 
Weak hits

Sequence:  WP_012265968.1.4043
Domain Number - Region: 215-272
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00847
Family Myeloperoxidase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012265968.1.4043
Sequence length 1289
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MPNPNFDSVIDTFTIDDLFFLRYQYRVYKEWNNDPRLAVLPGFSPGVTGARATSGIRFVD
GTDQLRYQVGGGITPISAPYPLSTTDPKFMAGATGTLFRRLTSQSFTQATGGFTINFQTG
AVVYDQNYTLDYSLRGSANPSNPHIFDASPRLISNLVSNQSGKTALQVLDDPYAREWTQA
GTQAGKRVSQKNNTRHETILTGGNGVNGSNTGNPLPNSGFFALFGQYNDHGMDFLAKGKD
GSLLIPLLPGDSLYTPGSPTNFMALSRTNTVQVEIGEGSRDALVAELGLAGYSRPSQWDV
DNENAAIGTSFTGTSGGTLVLNEQLIVISAGATLNDIVTTINSKAAFTGVVASTTTNGSS
QSVLKLTPRNGESFNQTSAFFDLNQVYGSVESHAIFMREYKGNGELTGRLLADPQNSTAR
WFDLKKNAERIGLTLRDRDVLSVPLVEIIPQGQPNAGRYAFVVLDKVSGQKSYVFDTADV
TSNQVLAKAGSAFLIDLARDWKGSPQPAGSDPFKANGDLKDPSRLNEHAVGGDGRLNENI
GLTAMHEIFVTTHNNILSQIEANLAQNAGNNGNNQALSGQELFEMAKLANENFYQHHVLQ
EYARRITPNLGAFAGANAGNNNNAGFNASILAEFASSAFRFGHSQLTETVALTSVNQQTG
LANPGGQMDIPLLQAFLAPQIYTRHTAGQIAAGMSQQVGNATDEFITNTLQNALVGLPLD
LGALNIARGLDTGITSLNEARRQIQTYLRDVRTSPGGTTGLVQANNAIDANLASLEANLR
PYISWKDFGAHLLHPESLKTFIMAYARDAILSGYSGNANLSYWNQLQASSAPGAAATYAA
ALSAAADLAMGDDAFMGLLYSGSSSDALNPSAPVNTPSGNQDFQNISLWLGGLAEAKTPG
GMLGPTHDFIYAYQMQQLQRGDETYYLSKLAATDLVEEIKGKTVADMVMAATGVKHLYHK
IFAVNDADYERSLQSFNTYSSEALLLGATQTVVDVTGTQRLVGRAGYVNGVLVGNGGNYL
DARGVFSPNGEGKASELFGGTNGSDQFKGLAGDDCMWGDGGADTFWAGDDNDFADGGEGH
DTIYGENGFDMLRGDAGNDQIYGGTGNDDMYGGEGNDSLFGEDGIDDLNGGNGNDLVSGG
LGNDQVKGQAGNDTLIGGQGNDIITGGGGNDLFTFNEAPGLNGVDQLRDFNSTLDKLVFD
KNVYAGLSGSTLTAAQLRAEAGATVATTASQRFIYNLSNGDLFFDPDGTGVLAVTQIANL
NRFNPAFPSDVASANAVFPNLVSSNFLLI
Download sequence
Identical sequences B0JKJ9
449447.MAE_29660 gi|166365707|ref|YP_001657980.1| WP_012265968.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]