SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012268252.1.4043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012268252.1.4043
Domain Number 1 Region: 558-679
Classification Level Classification E-value
Superfamily CalX-like 2.49e-27
Family CalX-beta domain 0.00095
Further Details:      
 
Domain Number 2 Region: 1214-1403
Classification Level Classification E-value
Superfamily beta-Roll 3.59e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00039
Further Details:      
 
Domain Number 3 Region: 437-566
Classification Level Classification E-value
Superfamily CalX-like 2.22e-25
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1106-1224
Classification Level Classification E-value
Superfamily CalX-like 1.44e-24
Family CalX-beta domain 0.0019
Further Details:      
 
Weak hits

Sequence:  WP_012268252.1.4043
Domain Number - Region: 19-240
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000112
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number - Region: 692-955
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000239
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 
Domain Number - Region: 261-463,503-541
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0129
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 
Domain Number - Region: 886-1098
Classification Level Classification E-value
Superfamily YWTD domain 0.0149
Family YWTD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012268252.1.4043
Sequence length 1479
Comment hyalin repeat-containing protein [Microcystis aeruginosa]; AA=GCF_000010625.1; RF=representative genome; TAX=449447; STAX=1126; NAME=Microcystis aeruginosa NIES-843; strain=NIES-843; AL=Complete Genome; RT=Major
Sequence
MSIPFLVKDISPYGSLPLELTAVGNTLFFGADNGVNGRELWKSDGTAAGTVLVKDIRPFS
GSYPGYLTAVGSTLYFTAGDNVNGPELWKSDGTAAGTVLVKDIFPGYSYSPPGYLTAVGS
TLFFTVDDGVNGDELWKSDGTAAGTVLVKDIFPGYSYLEPYPSNLTAVGSTLFFTANDGV
NGRELWKSDGTAAGTVLVRDVRPGSYGSHPRYLTALGNTLYFQAFDGVNGTELWKSDGTA
AGTVLVKDIRPGSFSGSHPRNLTAVGNTLFFTADNGANGEELWKSDGTAAGTVLVKDIAP
SSSSRSPRNLTAVGSTLFFTADDGVNGEELWKSDGTAAGTILVKDISPGPGGSLDFSTQM
TAVGSTLFFTADNGVNGEELWKSDGTAAGTILVGDIRPGSNGSNPRNLTAVGNTLFFRAD
NGVNGWELWAVSTPAIPTLAIAATNANQTEGNSGSKAFTFTVTRSVITTGSNNVDWAVIS
SGSNAANATDFVGGVLPSGTVSFAPGETSKVITVNVLGDTTFEPNENFTVILSNPTNGAN
ITTATATGTIENDDVAIPILTIAATSSSQTEGNSGSKAFTFTVTRADNTTGSNNVNWAVT
GTGTFPANAADFVGGVLPSGVVSFAPGESSKVITVNVQGDTTVEPNENFTVTLSNPTNGA
TLGTPSTATVTIVDEDSVPFLVKDIYPGSFGPYPSNLTARGNTLFFTAYDSVNGEELWRS
DGTAAGTVRVADISPGDYGSYPSNLTVVGSTLFFQAYDSVNGIELWKSDGTAAGTVLVKD
INPGDSSSYFYNLTALGNTLFFTVDIGRTEELWKSDGTAAGTVLVKNIGPEPSNLTAVGN
TLFFSARGVSGRELWKSDGTAAGTVLVKNIRPGSSSSDPRYLTAVGNTLFFNANDGVNGL
ELWKSDGTAAGTVLVKDINPGSYGVPPRYLTAVGNTLFFSANDNVNGEELWKSDGTAAGT
VLVKDIRPGSFSSSNPRNLTAVGNTLFFTAGDNVNGRELWKSDGTEAGTVLVKNINPGSG
FSGNYPQNLTAVGNTLFFTADDGVNGRELWKSDGTAAGTILVGDIRPGSSGSNPQNLRVV
GSTLYFTADDGVNGRELWAVSSPAVPTLAIAATSANQTEGNSGSKAFTFTVTRAVNTTGT
NNVNWAVTGSGTNPANATDFVGSVLPSGTLSFAAGETSKVITVDVQGDTTVELNENFTVT
LSNATNGATITTATATGTINNDDFIGTSGPDTLAGTSGADAMTGLAGNDTYTVNDAGDLV
IEAFNQGTDTVQAAISYTLPNNVENLLLTGTGNLNGTGNGLNNQITGNSGNNSLNGAAGT
DTLIGGAGNDTLNGAAGIDTLTGGTGTDIFIFRFGQSTAAALDRVTDFAIGTDKIDLLSQ
AGAAINAPLAFTRATDSTTTNINTIVTNVFTDANGATAGNQALGINSAALVRDNSSSTYL
IINDGTAGFQSANDLVINLTGLTGTFPALGTIAVNSFFV
Download sequence
Identical sequences B0JK74
449447.MAE_61060 gi|166368847|ref|YP_001661120.1| WP_012268252.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]