SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012309526.1.97847 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012309526.1.97847
Domain Number 1 Region: 3-75,161-334
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.01e-55
Family Bacterial dinuclear zinc exopeptidases 0.00000975
Further Details:      
 
Domain Number 2 Region: 66-169
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.08e-22
Family Aminopeptidase/glucanase lid domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012309526.1.97847
Sequence length 337
Comment peptidase M42 [Candidatus Korarchaeum cryptofilum]; AA=GCF_000019605.1; RF=na; TAX=374847; STAX=498846; NAME=Candidatus Korarchaeum cryptofilum OPF8; AL=Complete Genome; RT=Major
Sequence
MDLKLLERLSLASAPPGFEDEVREILKEELEGRVDELQEDGFGNLYAVKGSGRKVMFAAH
MDEVAMMVRHIDERGFLRVVALGGLSPSQLVAQRVVVHGKVKLRGIVGTLPAHMGEEKIP
KMDELYVDVGASSGEEARSLGIRPGTLITFDSPFIYQPETGSLIGKALDDRLGCFLLAEA
LKSVEPGEKIYAVFTCEEERGLRGAQVAANRVRPDLAFVLEGTIASDVPEVQEYNYITQL
GKGPAIRVMDRGLIVKGWLLESIIARAEGLGIPYQLQLSPVSSTDAAPISLSGDGVAVGV
ISVPARYIHSPQALAKVSDIENSLKLVKSLMEDPPRK
Download sequence
Identical sequences B1L5A0
WP_012309526.1.97847 374847.Kcr_0883 gi|170290496|ref|YP_001737312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]