SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012309637.1.97847 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012309637.1.97847
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-26
Family GHMP Kinase, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 161-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.88e-17
Family Homoserine kinase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012309637.1.97847
Sequence length 297
Comment homoserine kinase [Candidatus Korarchaeum cryptofilum]; AA=GCF_000019605.1; RF=na; TAX=374847; STAX=498846; NAME=Candidatus Korarchaeum cryptofilum OPF8; AL=Complete Genome; RT=Major
Sequence
MRAFCSSANLGPGYDIVGLALNAFHDIVEVELVKGDGRAEVVDVRGPYSNSIPLGERNSA
AEAARAALKLAEQRLDAKIRIWKGVPPRRGLGSSGASAAATVRAIDILLGGVLKDEELVK
AASEGERISSGSAHPDNVAPSLFGGLVVIGREVLKFKPDFEFLLAIPWIDVPENKTEYMR
NLIPKEVPLDKFSKHCLHLSHLMLGIALNDARIFGEGMNYSFIDECRSRSIPGFDELRRR
ALENGALGVSISGAGPSILILCEDCPRVSRVLRDEFKRIGVPATILEASPAEGASAL
Download sequence
Identical sequences B1L5L1
gi|170290607|ref|YP_001737423.1| 374847.Kcr_0994 WP_012309637.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]