SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012310067.1.97847 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012310067.1.97847
Domain Number 1 Region: 10-349
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.58e-52
Family tRNA pseudouridine synthase TruD 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012310067.1.97847
Sequence length 359
Comment pseudouridylate synthase [Candidatus Korarchaeum cryptofilum]; AA=GCF_000019605.1; RF=na; TAX=374847; STAX=498846; NAME=Candidatus Korarchaeum cryptofilum OPF8; AL=Complete Genome; RT=Major
Sequence
MEVPPIDSHLGMLTYMSGGSPINGRLREKLSDFIVDEVLLGKRASRAFLGIDKFEGGGVS
YLVVMKRVRMDSFEMISKLSKKLGRRVGYAGMKDARSISFQFISVQGSLRELPEMEGLSL
RYAGRGEMIYLGMNDGNHFTVVIRGADTIELPKIFPNFFSYQRFGVKRPYNHEIGKAILL
RDIEGASSMISEQGYEVSAARSLKQLSEMIGSELIRFYVHSYQSYIFNLILSRRIELGID
PRHGDFVLRPNGEIALYPERGSLLLPLVGGLTEARGWLAEELASILREEGVSKEMFIFRE
LPEVSALGDFRKAFCEVEPKIVEREGFIVLSFFLESGAYATSYLREIIKPRDPIAQGFI
Download sequence
Identical sequences B1L6U1
gi|170291037|ref|YP_001737853.1| 374847.Kcr_1424 WP_012310067.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]