SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012310076.1.97847 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012310076.1.97847
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Prefoldin 0.00889
Family Prefoldin 0.013
Further Details:      
 
Domain Number - Region: 71-185
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00994
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012310076.1.97847
Sequence length 245
Comment hypothetical protein [Candidatus Korarchaeum cryptofilum]; AA=GCF_000019605.1; RF=na; TAX=374847; STAX=498846; NAME=Candidatus Korarchaeum cryptofilum OPF8; AL=Complete Genome; RT=Major
Sequence
MRGKVSGYLLSSLKEYFGDEKGEKIAEILSRSNIRCFDDLSTDIPDSLIELMEVSKSSFR
NFLEEYGPQAIAKLKERVEDLSSKVKQLETQIGWAKERIQQSIDFRSSTSLRAMRELDVA
IGILSSIVSSIQICCEKSSGIDERKAEIYSKTINEAAERLRRASDSDEEFSEQLKDAASS
LERIVEIMRELRAGDLLDLLNYTLSILSDIKRTRMRLDFDKNSLILENILLKSKIVSLLC
SRFNP
Download sequence
Identical sequences B1L6V0
gi|170291046|ref|YP_001737862.1| WP_012310076.1.97847 374847.Kcr_1433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]