SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012326679.1.77901 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012326679.1.77901
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-19
Family SMI1/KNR4-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012326679.1.77901
Sequence length 186
Comment SMI1/KNR4 family protein [Shewanella woodyi]; AA=GCF_000019525.1; RF=na; TAX=392500; STAX=60961; NAME=Shewanella woodyi ATCC 51908; strain=ATCC 51908; AL=Complete Genome; RT=Major
Sequence
MSKDISELCAKIKWKPIDTDYGATKESYLSSNEELIAIERFLQAKLPDDYLWFMKNVGRR
LIDDRRINIKLNGVSLSFLDWFRDAIDVLTFTQMASEKEDKMQTSFNLVVISSSISHDEV
LLDVSAGHYGNIWFKHHNPKWRQKFSENPEGLVLIANSFTDLFSKIVNNHSPGEIDFNFD
DDDEII
Download sequence
Identical sequences B1KH38
gi|170728419|ref|YP_001762445.1| 392500.Swoo_4094 WP_012326679.1.77901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]